DPCstruct | MC21873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6XP33 | 8-132 | ELLLKSHEAAEPEPEEEKAEQPELPRLKNNDQRAAFVDDYESWPLWIDNQETGERYYRYDLPDGTSFVVKVYHAMIFLGWEVESGSR… |
| A0A1C5QSZ5 | 14-127 | EKQLGLPVLKNNEQRRAWLRKYKEWGLWYEDENIGCKYYKYDFDNGARLIAETYIIPGNELIPERESCYFHLVGGPEAEKKNGVPKW… |
| A0A3E2N8W5 | 26-160 | None |
| A0A1H9YK66 | 1-110 | None |
| A0A1C6K9C3 | 626-740 | None |
| A0A3R6XI34 | 99-208 | None |
| R6BCJ9 | 1-91 | None |
| A0A1C5VNT9 | 5-101 | None |
| A0A396QAA3 | 67-169 | None |
| A0A1C5REH6 | 468-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.