DPCstruct | MC21871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U7EJN7 | 122-194 | MTIKSQTHKGEGYNELRFEDEHGQEEIFVHAQKDQNIRVNHDESTFVGHDRSERVENDETIAIGHDRRETVGN |
| A0A1V3KT93 | 1-64 | MYLKSKTYKGEGYNSIMFDDATHNELFQQHAERDMETQVKHDQRNHIQNDRTFIYSSFNTYLMS |
| A0A285Q8L9 | 77-163 | None |
| A0A7W6XUC5 | 203-284 | None |
| A0A656C0P8 | 1-74 | None |
| A0A4D0Q034 | 121-194 | None |
| A0A1V3K9U1 | 1-64 | None |
| A0A707ZVV9 | 17-89 | None |
| A0A1Y6IR12 | 476-562 | None |
| A0A2U8WUA5 | 819-890 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.