DPCstruct | MC2187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 155 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1AAT2 | 1-143 | MEISEETIRKRNLEEIKKAVSDHKEAVLKGIDFLETLNKSGTLDMVDALIKHREDALENVMREINKPQYAATLENLPKLLILIGELN… |
| A0A150JNL9 | 1-155 | MAKAIRQIKQVDPAPEEWQAASMSAVVKAAAENGESLIKLLEIIKQLDGMGVLNAMEGLLQNRVDVAEIALGQLNQPAMYHVIKNGM… |
| A0A7C8KPG6 | 1-160 | None |
| T0C9Q7 | 1-157 | None |
| E7RD13 | 1-158 | None |
| A0A0Q5LBV4 | 1-149 | None |
| A0A223D199 | 1-159 | None |
| A0A837YXX2 | 1-149 | None |
| A0A1N7KTK6 | 1-160 | None |
| A0A4P6UVI6 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.