DPCstruct | MC21867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 269 ± 37 aa |
| Standard deviation of domain lengths | 36.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4V975 | 6-298 | GDFLKDKYWGNKEFLEAADISARRTKKREGENVPNIPPERIENYLDRFKEITDREDPEKREHGIAAIERLVEKKYIIKPKNISDDYI… |
| A0A2M7RCN4 | 7-223 | GEKVPQNPDQQIQTYLDRLERLVLDPDKKQSRKMEGGQSRPRALSLLREMVMNEYIRPNKEKLAEGAARVEERAARNLGMDIEYGEE… |
| A0A0G1C7Z5 | 1-231 | None |
| A0A660M577 | 5-275 | None |
| A0A1F5NTS7 | 1-286 | None |
| A0A0G1JKL1 | 1-308 | None |
| A0A849WSS8 | 55-314 | None |
| A0A857VFP6 | 106-472 | None |
| A0A563C8W7 | 44-306 | None |
| A0A0G0JG57 | 4-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.