DPCstruct | MC21860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 72.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9K908 | 3-84 | QEIRTATSSMTSVPKPLKFLRPHYGTLKASFETMPDSDLKKYMADILSVLALTMSVEGERESLKYRMMGSEGDIGSWGHEYV |
| A0A835DU69 | 1-74 | MTSVPKPLKFLRPHYGTLKTYYEIMGDSDLRKYLADILSVLALTMSAEGERDSLKYRLLGSEGDIGSWGHEYVR |
| A0A287XHG4 | 2-81 | None |
| A0A835RKZ1 | 83-174 | None |
| A0A6J1W0N2 | 42-127 | None |
| A0A351FH63 | 1-72 | None |
| A0A835D0Q6 | 1-73 | None |
| A0A3L6EJ00 | 452-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.