DPCstruct | MC2186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 178 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846RGF9 | 94-283 | QWESVMQFARRIRDHTVPGGVWINSDVCGPADRRRQVILRLTTTDGSNPPAPRTDLAELTSGEVKRYVEGLSTRARLDQFATDFAFP… |
| A0A133KMN3 | 2-145 | IIRDGIMTEPKDLIRLLAFRDPDGFRFFTRYVEDFKGRKIDYEITEDNKIKLPVNDLMEFLYTYTWGEEAYPHEVQEQFGYFTPSEY… |
| A0A7W0Y8B1 | 10-176 | None |
| A0A0G1QG45 | 138-330 | None |
| A0A849WVM0 | 165-349 | None |
| A0A0Q1BI44 | 157-332 | None |
| A0A7X8JVV6 | 698-869 | None |
| W7YI91 | 27-198 | None |
| A0A3A0GBC2 | 356-542 | None |
| A0A1F5FH46 | 319-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.