DPCstruct | MC21859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 159 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9LTC7 | 174-320 | RREKLNDKFMDLSSVLEPGRTPKTDKSAILDDAIRVVNQLRGEAHELQETNQKLLEEIKSLKADKNELREEKLVLKAEKEKMEQQLK… |
| A0A835DR42 | 26-189 | FPAPETGFNWPTQTFNGSTNVRFLELGSILEPGRPPKMDKAAILSDAVRMVNQLRSEAQKLKESNENLQEKIKELKGEKSELRDEKQ… |
| A0A4D9C173 | 266-434 | None |
| A0A2I0KAV8 | 63-222 | None |
| A0A2I0WZ98 | 2-157 | None |
| A0A830CJ50 | 2-145 | None |
| A0A835JC55 | 67-246 | None |
| A0A835XWQ2 | 91-234 | None |
| A0A4S4EUT9 | 127-289 | None |
| A0A5J9U7H3 | 5-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.