DPCstruct | MC21858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 216 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O81657 | 1-222 | MLAAYWTTLAPNVEDYSGSVARVIAMGSGRVIQGILWCGDVTVERLKWGEQLLKRKMDPNAQSSRVSKEALQRMKRVKKVTKMSDKV… |
| B5Y3I6 | 336-577 | LICQAWIDATAETTANCIETGAHVIKLGLTHSTTLVTTGIDAMGDVVQSCIDPVLREAGTNTEYDPRSTAAALTYTGAARRVTRQAR… |
| M7TSW6 | 99-271 | None |
| A0A7S4KA81 | 260-489 | None |
| A0A7R9K4Y6 | 222-412 | None |
| A0A0L0DFH9 | 155-392 | None |
| A0A0E0LFQ4 | 252-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.