DPCstruct | MC21857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 76 ± 16 aa |
| Standard deviation of domain lengths | 16.00 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G8R6N6 | 3-72 | AVPSVVIKDGEMMLKEIKKAKLTTGEVEVSLRQNKVGNIKDVDLAIFESNGKLSTILNNEQAAATKKDIQ |
| R1CW57 | 64-135 | KTPFKLEPNIDSLQLPLELILNGEILTENLKAIRKDNEWLNKTINKKRINNIEDIDYAVLDSTGKVHVENKI |
| A0A645J7I8 | 27-111 | None |
| A0A841SRW6 | 23-95 | None |
| A0A1I1P8K7 | 40-150 | None |
| A0A650LRI4 | 3-71 | None |
| T2RFY6 | 55-134 | None |
| A0A7C6VCY3 | 126-239 | None |
| A0A6N0WXT8 | 1-56 | None |
| A0A7C6VFY6 | 89-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.