DPCstruct | MC21854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 201 ± 48 aa |
| Standard deviation of domain lengths | 47.71 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 81.57 |
| Assigned Pfam label(s) | CL0286- CL0279- PF02245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3Y3T3 | 329-549 | MRVKEGEADYRYFPEPDIPPLRLDADLLSAWKAALVELPAAKRARYVRDLGLDAEQARVLTDDQQTAAYFEAAVAAGGAGCAPVEVC… |
| A0A7J4B288 | 2-147 | LRELEKQTNKELAVQLLHSTYLGAYEKAVGMGIDPKVAAVTFVSTLKTIAREGLPAYNIDPDKVIEVLKKYAEGKITKKAVEEVLRE… |
| K2S685 | 62-318 | None |
| A0A482WU22 | 220-451 | None |
| A0A3T0Y475 | 792-1005 | None |
| A0A1R0GR32 | 1-128 | None |
| A0A0G0V2N4 | 202-436 | None |
| F4Q6Y1 | 2-146 | None |
| A0A4Y7L8Y3 | 347-486 | None |
| A0A832ZXA5 | 208-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.