DPCstruct | MC21853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699Z282 | 4-103 | DDCCAVCAEPLEWTGVSICGHKETCSKCVARWRFVLKDTRCMVCKTEQPRILFTRFMGDFTTRLTAEQYDDLKRRADNGEVNYIAAI… |
| A0A7S3Y343 | 2-127 | RQQEEEEEEGPHCMVCAEPLVHYAVGECNHHGTCSLCILRLRVVLKDRRCPTCRTPMDKVVVAQLHEGAAPRPFESFGLWGEVAPPE… |
| A0A0D9V244 | 745-840 | None |
| B0EF82 | 3-114 | None |
| A0A1Y2H9M1 | 125-240 | None |
| A0A3S1A4I7 | 4-125 | None |
| A0A2J8AJQ7 | 380-503 | None |
| K4A2H1 | 2-103 | None |
| A0A0K0EE56 | 224-355 | None |
| A0A0V0QDB8 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.