DPCstruct | MC21851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9ILS3 | 65-205 | SAGLNFHGSSIYRNLKRIAESKGITTFEFEYYCTVLSPGRIRQRVFFPFHILSRPQAESIGWDWHILFQICRDMLKKMRKECSKHAE… |
| A0A559KT05 | 438-562 | IYDNLLRIAQSYDLSVSEFEYYCTVPSPRFPQKRVFYPFYILSKPQAQQSNWDWPVMLKVAEEMLFNMRRFCNKHAEQAGHGEKHMN… |
| A0A2T4B3I3 | 1-146 | None |
| A0A2T3ZP75 | 447-569 | None |
| X0M1P7 | 433-576 | None |
| A0A1J7IN63 | 186-307 | None |
| A0A2H3S0Q8 | 429-574 | None |
| A0A430KZG3 | 492-634 | None |
| A0A420MK17 | 567-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.