DPCstruct | MC2185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 236 ± 51 aa |
| Standard deviation of domain lengths | 51.20 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1ZN40 | 1-221 | MNQIADLQVNHKLVLEVQCSSLPPDRLVERTKNYRDNDQYIIWLLGKNLWIKHKLSYLQKQFLSFSWSIGFYLWEIDLEKNCLRLCY… |
| A0A133KF35 | 38-285 | RKYRQLFAIEYQCSPIPFERLMERTEGYRHLGILPVWILGGMPFRSSGKEAESVYRCSDFQLSFLRHIRHHFYLFSYAPGKKKVCLL… |
| A0A1U7PM14 | 155-436 | None |
| A0A3E2JCE8 | 196-472 | None |
| A0A0R1JB46 | 137-334 | None |
| A0A6G8B0P3 | 102-227 | None |
| A0A0R2BUT1 | 1-256 | None |
| A0A061NTF4 | 110-277 | None |
| A0A062WY71 | 1-190 | None |
| A0A0R1LG51 | 3-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.