DPCstruct | MC21849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 323 ± 44 aa |
| Standard deviation of domain lengths | 44.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9MQ74 | 33-280 | TLDSSGVAGFFGGDSAVSGMATVNLIPSRRWGGWYNTPGSYEIAKQYGQLAGSKYWNGLFPGGNDDPAKLFELDGKLGPKFIAAHSG… |
| A0A0G0APF2 | 206-562 | NPSDIFSLLLLVGGDVIQKALAQFTLNRFRPMAFSFGWVAYAFGHLLFAVGNLKALPDPDCPCTITRASSMPTTSANQSWLLGRLVR… |
| A0A1V8SSY8 | 9-302 | None |
| A0A1L9PB71 | 4-249 | None |
| A0A395GRJ4 | 16-320 | None |
| F8NPM4 | 3-314 | None |
| A0A6G1LTV7 | 1-329 | None |
| A0A2H3D5I6 | 114-469 | None |
| S7Q5H1 | 2-207 | None |
| W2S965 | 19-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.