DPCstruct | MC21847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2WT16 | 3-128 | GKLLFIDLRSMDFNLLELKRDENCGACGRGLATEIEQPLVELGCARDGKSVYFVNKFIDGFSMDEAVASISKIGSVMRRGDQFIKFK… |
| A0A151BIA0 | 140-265 | NKMLHCDLEKMEFEEVEISKVETCPVCGSKPSGSPMPLKQKLVTEICGREGRRVFVVTPKRNLELNMDELYSRLINEGFRVKVKADL… |
| A0A2N9N6F8 | 58-177 | None |
| A0A3M9ZHZ2 | 57-204 | None |
| A0A523E8Z9 | 700-823 | None |
| A0A852TJN6 | 4-133 | None |
| A0A832XYK2 | 65-190 | None |
| A0A109V6D8 | 12-136 | None |
| A0A7J4F4T0 | 88-208 | None |
| A0A838J4L1 | 122-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.