DPCstruct | MC21846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6TWK9 | 143-223 | VNTRKARRKQKKLAKQEKRDAKFLKRRRIRLIPIWIRLIFVIALFAGSLIAGTMVGFGIVGDGNPRDVLEAETWYNVYDFI |
| A0A4Q4JHQ8 | 65-146 | LKKAEQETEADRKKKESEKALNNPFFGYRKRRFPIWQRLIALISLCALALVGGAMFGYGVLGDGSPWAVFDWDTWRHILDFL |
| A0A7X9QQH5 | 112-182 | None |
| W1SEI2 | 7-102 | None |
| A0A6B3W0C4 | 7-108 | None |
| A0A7S8HG71 | 59-129 | None |
| A0A2S5G991 | 5-87 | None |
| A0A1C7DF36 | 1-87 | None |
| A0A285CI54 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.