DPCstruct | MC21845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0MHD0 | 48-219 | RYLLVGLLALVGLHWLALFMSPSYAASASLEAIAFKSGLGSDGSPSSWHDSSTTNLDDLTSVGGTGLAPFESLDPELNAITFVILAR… |
| A0A1Y3MXI6 | 8-119 | LLTIVNFLAIFVLYRFLFKVFNKEPKEIDYSYLYNKNETDIKACIFILCQDKDQEKLIKTIHELEATFPHKYPYILLNDVPFSDTFK… |
| E3RU58 | 1-157 | None |
| A0A0N0NJP0 | 27-206 | None |
| A0A370TLK4 | 1-149 | None |
| A0A146IMZ2 | 342-560 | None |
| Q2GND4 | 807-920 | None |
| A0A6A5WA99 | 2-193 | None |
| A0A1E4RI66 | 282-456 | None |
| A0A5Q7YAG3 | 12-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.