DPCstruct | MC21844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0LB00 | 1-150 | MRLSFVLSSVLLSLGVSGAPVLSAAPAPSPAFIKRHAHHSTSDKHSSQNTSTSTSFTTEVKILESCSAAQTHHLRQGLEQMLELANH… |
| Q0CZU2 | 1-115 | MISLLSSLLLASVVAAVPAPAHVARSTNTTTPAAWDAGAVTQYPIHASCNATERHQIEVGLNETIALADHAKAHILRWGNESAIYRK… |
| A0A3N2PRV4 | 76-202 | None |
| A0A1E3B6L5 | 1-113 | None |
| A0A0D2G5Q1 | 1-118 | None |
| N1QCN3 | 1-114 | None |
| A0A2W1HV57 | 1-125 | None |
| A0A1Z5TLY9 | 18-141 | None |
| A0A7C8IL17 | 663-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.