DPCstruct | MC21843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366W6G5 | 2-93 | PDVTIVYWRDMPAQVIVGRGRKGAKMPLPERFEQAIDRAAMKSGAAESDDYLAGFRKAAPYPVDGTPQEAAEAEATRIDTEFDQTRL… |
| A0A6I2V5X0 | 1-88 | MSEYQIMRWREIPSMVIARESETTIKVMLASRFQEAIDEAAMRLGDIDADAYTAGWNRDPWVQATESADLLAARIATELETELSEEKL |
| A0A6N6L6T8 | 6-100 | None |
| A0A7Y1TYI3 | 7-106 | None |
| A0A2L1TIA8 | 103-194 | None |
| A0A2E3CSB2 | 6-98 | None |
| A0A2R8AWI6 | 1-64 | None |
| A0A536DV73 | 1-88 | None |
| V9GIP8 | 44-137 | None |
| A0A6N9CFL9 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.