DPCstruct | MC21840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 208 ± 26 aa |
| Standard deviation of domain lengths | 26.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4Q980 | 5-246 | NSIRQVISGKNFEDIGNIEPICPNCGKALQSKPSRKKECPECGKLMFVRTRPSDNKKVLVTEAQAEVIEEQWSIANGTHETYLKERN… |
| A0A1I4P457 | 163-337 | NKSFFQCTDKAIEMLANNQHIMYSHRHQNDIGISVMDADNFKKTNPLLNHYQLFLEMLTIKLHEYEQDKRWISYRNAILSMSIIYGD… |
| A0A1V4YUC6 | 350-547 | None |
| A0A1Q6T0A9 | 163-354 | None |
| A0A2G2GBK7 | 55-288 | None |
| A0A431WWK6 | 2-231 | None |
| A0A3G6MIN7 | 22-206 | None |
| A0A521GRQ6 | 66-323 | None |
| A0A378JYF4 | 110-358 | None |
| A0A853NNF6 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.