DPCstruct | MC2184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 130 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7WTI8 | 9-135 | AGPRAWQVWLRTILGAVAANLVLRAAALAVFDIPPEFEPLATAVPTAFLTVVGVAAGLGVALAVDHRSERPVPLFRRIVLVALLLSF… |
| A0A2H0SIR5 | 7-142 | QTYLQAAVVAAVIATVANTVIFLVGQALQVDFMVQFPGATDLQPVQLAMVAVSSVVPVAVAVVLLAVLQRLVVAGMKVFESIAVIVL… |
| A0A1G2SD72 | 1-137 | None |
| A0A4P5UR45 | 6-127 | None |
| A0A6J7LPZ6 | 1-126 | None |
| A0A3A1U225 | 1-150 | None |
| A0A3C1DMF7 | 15-151 | None |
| A0A2E0WD35 | 37-169 | None |
| A0A243RCN3 | 7-134 | None |
| A0A7Y5ZDZ6 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.