DPCstruct | MC21839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 309 ± 65 aa |
| Standard deviation of domain lengths | 65.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3JSE4 | 547-887 | SATSLAAARLLLTGVASDTVDIVLPKGQHVAMRLAFCRATDDGGAEAGTIKDAGDDPDVTHGALVFARVRLVHEPGVRFRAGPGVGT… |
| A0A7L4PPZ2 | 6-249 | WCRAVKDGGDHQFDITHGLEIEARARAAPETGMVPGPGIGVVARGGLCAARGKPAISRSAREQIREAMEEGLKEAGLEGAVVELCIP… |
| A0A6N6X759 | 2-163 | None |
| Q1NN74 | 16-293 | None |
| F1YVW5 | 1-243 | None |
| A0A1V5HVK1 | 255-596 | None |
| A0A3A9FNN8 | 247-636 | None |
| A0A7J5H740 | 264-629 | None |
| A0A417MJ73 | 28-373 | None |
| A0A413H2D3 | 2-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.