DPCstruct | MC21838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 94.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829FNV8 | 1-58 | VKGNQGRLNKAFEEKFPLKELNNPKHDSYAISEKSHGREETRLHIVCDVPDELIDFTF |
| A0A1Q9KYH7 | 39-95 | VKGNQGRLNKAFEEKFPLKELNNPAHDSYAMSEKSHGREEIRLHIVCDVPDELIDFT |
| A0A6D0C4K7 | 48-89 | None |
| E1JGA9 | 1-69 | None |
| A0A836NGB3 | 160-217 | None |
| A0A7U9P1F9 | 2-62 | None |
| A0A7U9J1X6 | 1-50 | None |
| A0A828IM47 | 99-162 | None |
| A0A823BQW7 | 72-128 | None |
| L4JFM0 | 42-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.