DPCstruct | MC21837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4TP89 | 1-116 | MKNSKPTFEDIITYLFEKTGNVEPSFSSKMLATIIPEKPIWDRYVAQNLNIKLSGLSQEEKLKSAIEKYSEMEQWYEDFLNSEDGHN… |
| R6ULT4 | 1-130 | MRQRSENFYRCFYRYLEEHKFDTALTYEQVLTYLFQETGCIHASFSSKLLATVRPEMPVWDKYVLSNLGLKAPYYSCKSRFQKVLDT… |
| A0A1H6XBC1 | 48-181 | None |
| A0A8A5D425 | 2-100 | None |
| A0A829YAW6 | 1-112 | None |
| R9J0Y2 | 196-326 | None |
| A0A2E0U3J0 | 40-172 | None |
| R7N9N3 | 55-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.