DPCstruct | MC21836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838GTE4 | 35-165 | QLADELKAITDNYLVAHIVRPNFGGKVFCAHKVLDVEEKGDAVNEYVYTICQEYNSRNEVLREGTGTGVPVVLQIEKRDREYQVISH… |
| A0A3D9SD49 | 190-322 | DQAANEAISNYIVEHYKDVYSGTDKSFEVHKVYGSAKAGNEIKVYMYSLYGGFNKNSENSMNGHSLPAVVTLKQEDGAYTVTGYKEP… |
| A0A353PYK4 | 186-338 | None |
| R6FAQ2 | 4-103 | None |
| A0A239R0Z2 | 227-370 | None |
| R5MSQ3 | 581-718 | None |
| A0A7W7HN79 | 5-178 | None |
| A0A355JFI2 | 202-330 | None |
| A0A1H3SMR9 | 288-429 | None |
| A0A1I7HCX5 | 25-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.