DPCstruct | MC21834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W7YVS2 | 69-149 | EILKTLQQTTHWASANRDELVQLASQDTGLDPEVWRTAYGRANLDLQPISTAHVAQQQQLADSFHALGIIPRKLQVQEIVW |
| A0A5C9CCL7 | 1-81 | MQQHRPESIKLISTISGLDAGVVSRFLQRRPTLPVGPISSSALQSQQRVADAFQKLGLIPKRIDVTQIAWQPNASVLAKTK |
| Q3SUU4 | 2-83 | None |
| A0A212SGS8 | 53-135 | None |
| A0A485A7J2 | 50-136 | None |
| A0A550F8N9 | 161-245 | None |
| A0A7H4M760 | 1-99 | None |
| A0A522C5S5 | 53-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.