DPCstruct | MC21833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9C5P9 | 1-58 | MMSYVFAPPPVVSVPVTGSNDQFPVHRIYCVGRNYAEHAQEMGHSGREPPFFFMKPAD |
| A0A2H4ZC35 | 1-62 | MSQYTHEPARVATALIEGSDQLYPVRRIFCVGRNYAAHAREMGRDPDAEPPFFFTKFPETIV |
| A0A534AMI7 | 26-96 | None |
| A0A1N7SIW9 | 1-58 | None |
| A0A6A5L442 | 259-316 | None |
| A0A6A5L625 | 108-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.