DPCstruct | MC21831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1WXJ0 | 1-109 | MNSLENKIDFALIFNVKKANPNGDPLNGNRPRTDYDGFGEVTDVCLKRKIRDRLMESEHVIFVQGDYNVLDSHKNLKYRADSVIKDY… |
| A0A377IX72 | 2-92 | SAIQNRYEFVYFFDVTNGNPNGDPDAGNMPRLDPESSKGLVTDVCLKRKIRNFVEISSENEVGYEIYVKEKSVLNLQNKRAYEALGI… |
| A0A7C5VR96 | 15-95 | None |
| A0A1M6X254 | 4-97 | None |
| A0A0M2UTZ4 | 22-120 | None |
| A0A2S6CSQ5 | 1-98 | None |
| A0A416JG61 | 1-96 | None |
| A0A0B7MEJ8 | 3-86 | None |
| M6TFW3 | 3-93 | None |
| G4CEG8 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.