DPCstruct | MC2183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2CJW1 | 1-69 | MTEKQFPILGAKGKIKSVPWRLVEPHREQAMQNHRQSLEQLASRGGLCWVELFAVMQDWTWHEFEQFTK |
| A0A5C5Q7D5 | 1-80 | MPEQMPVMSHPSIKSIPMAMLEPFRRQAMKNHGQTLERLAERGGLCASEVLSIMDGIGWGRVKNCPENDALLVRRIEAWG |
| A0A0F9FD45 | 14-86 | None |
| A0A0F9ARY8 | 4-70 | None |
| A0A094J1E7 | 17-106 | None |
| A0A497BC88 | 2-84 | None |
| A0A1V5HV98 | 41-125 | None |
| A0A0C6G2L3 | 53-151 | None |
| A0A1G9RUY2 | 1-110 | None |
| A0A4D8Q0V1 | 113-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.