DPCstruct | MC21829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3BH30 | 28-89 | TVMRVRYIHEEIRSGRYPNGPKLAKHFGVNIRTIYRDIEAMRNSLDLPMEYSAARNGFYYTR |
| A0A7D3XGJ5 | 1-79 | MNIIESKRLIEYLDFLLRSGNAGTAPEIADKLGVSERTVRNYFEQLESIKVPLEYNPTLRTWKFSRPGRLVLCFIEDES |
| A0A1K1R2Q5 | 4-76 | None |
| A0A3B0CE42 | 1-64 | None |
| A0A2E3SMM7 | 9-72 | None |
| A0A1W2GHY4 | 1-88 | None |
| A0A2T8HFY6 | 2-65 | None |
| A0A4R7EPS8 | 5-75 | None |
| A0A177LNP0 | 17-86 | None |
| A0A4Y8L3T1 | 7-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.