DPCstruct | MC21828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 256 ± 31 aa |
| Standard deviation of domain lengths | 30.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A852PTI7 | 1-284 | MESKQKHLVKVSVINVINLRYHFSLIKGILDNLIELNLYLFKEYYTGTFTKNLSRHDICLIAEKPPPREEWGSERFDTIKDEIKKQF… |
| A0A2W4YR81 | 19-269 | KQSLGEQAVVNLPLIQAAVRELRDILDRLMGRVARLAQEHVSGTRTAECSRSDLIAIARIVGPKPSWTEDAFLDRKADAMAQFGLSS… |
| A0A5E4YMJ1 | 76-344 | None |
| A0A1B1UBH0 | 1-227 | None |
| A0A423NG57 | 38-310 | None |
| G1WQA7 | 267-515 | None |
| A0A6V7FK69 | 178-405 | None |
| A0A853WSJ8 | 84-369 | None |
| A0A849TZE5 | 18-304 | None |
| J7JDW9 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.