DPCstruct | MC21826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 155 ± 21 aa |
| Standard deviation of domain lengths | 20.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0123- PF06252 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4AMV1 | 11-139 | IAARKRAIFAACKAAGLDDDARRAVIYQVTGRHRSLTDCTLADLNAVLDHLNRGQQGYQGRKRVTPAPERAALLGKVDAMLAELHRV… |
| A0A4R3I3I9 | 11-168 | NREMRLIHVAKRELQLDDETYRAMLWSIARVKSSKDLDFTGRKKVLDHLKARGFKVRSKAAPSPQLAQDAESKKIRALWIFLHQIGV… |
| A0A2E6KNB9 | 29-191 | None |
| W0Q8R9 | 1-118 | None |
| A0A7X7KL84 | 2-164 | None |
| A0A029HHZ5 | 2-171 | None |
| A0A5U9VG09 | 5-140 | None |
| A0A2M7HGK7 | 65-241 | None |
| A0A5C7NM00 | 32-183 | None |
| B8FD24 | 17-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.