DPCstruct | MC21822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 180 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9DWN9 | 215-391 | QRSLYEGFKLGAIGCYDGPLSKIADALPEYGSYDSVRDELEAIMVLLLEEQLDNGGPTTFLDPEALKDTAAAHLVPKLEEVRKSEVE… |
| A0A524GAC0 | 5-171 | LLCALGLQEYGFIDCDLSELFGSLQEDTPIEIARKQVREALVYEIAKAVDKNKATTGLKLEGLLTKHGEIAKGAQQIINLREVEMKQ… |
| A0A842WVN5 | 25-240 | None |
| A0A842WV35 | 520-706 | None |
| A0A842WUX4 | 237-423 | None |
| A0A842WTN9 | 18-186 | None |
| A0A842QEI2 | 12-215 | None |
| A0A842TA02 | 2-164 | None |
| A0A524MB55 | 1-147 | None |
| A0A135VBN2 | 470-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.