DPCstruct | MC2182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 3 aa |
| Standard deviation of domain lengths | 3.29 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BM67 | 71-147 | TQVIVPYRDEDEKRHLKVLGDLGQVVSLEWDLRHEDQIAECMRHSDIVYNLVGRDYETKNFDYNSVHVAGAASIANI |
| A0A507C4Q3 | 269-346 | TQVVVPFRGNDDNKRHLKLMGDLGQIVPLRFDVRDEKSVAECVRHSDVVYNLIGRDYETKNFTYDQVNVDAARTVARI |
| A0A1L9VFT7 | 82-158 | None |
| A0A5D2F124 | 1-80 | None |
| A0A2P6NHA3 | 154-229 | None |
| A0A498MTT4 | 677-756 | None |
| A0A5J4YM25 | 439-516 | None |
| A0A816LV32 | 570-649 | None |
| A0A1S3X8F1 | 365-444 | None |
| A0A7J8PL92 | 40-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.