DPCstruct | MC21819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2VAV9 | 5-103 | QQKVNELRNEIVDSIINLLKEHELKELKLDDDLEDLCYVVWFDNEGNAYDSPVRKVSLDKNGISLDVVDEDTGFTATLYNHDLGCQN… |
| A0A1Y4JA23 | 9-116 | RTKATSVAEILDGLKRDAVQAVKHLLEDRRLEAMPVDAAIRLGWMDEDGQAYGGNITKVSLDGERLHVQVQDKDLSCLLDERQFMPG… |
| A0A412SC38 | 1-106 | None |
| A0A5M8P328 | 12-111 | None |
| A0A5M8P2V2 | 1-109 | None |
| A0A1Y3X268 | 1-106 | None |
| A0A4Y1WJT2 | 2-104 | None |
| A0A1A9I3N8 | 3-114 | None |
| A0A413I7X7 | 7-99 | None |
| A0A415SV49 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.