DPCstruct | MC21811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 82 ± 23 aa |
| Standard deviation of domain lengths | 22.59 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 70.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | CL0083- CL0199- CL0004- PF20481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067CBS0 | 64-148 | ADHVGLWAQCGGKDFTGSRACPAGAACVTVNEHYAQCQATATDAAHLPTYAQCGGSNNGFDANGKACRDEDTCFRFNAHFWQCLP |
| A0A2D4CFJ4 | 10-94 | MVAMRFDYQAYGVVATGSSTLPLLQCEPGFVCEAVNEFYFQCIRGGPAVALWGQCGGLGYTGSTYCASGARCHYYTRWYSQCLPA |
| A0A397F642 | 118-196 | None |
| A0A820N782 | 130-201 | None |
| A0A1Q5U7B0 | 244-310 | None |
| A0A4Q2DNC1 | 203-262 | None |
| A0A4Q2DQG3 | 885-958 | None |
| A0A6P8AZ97 | 333-390 | None |
| A0A5C3LL12 | 1-84 | None |
| A0A5C3LS24 | 10-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.