DPCstruct | MC21810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZS59 | 1-79 | MYKELSISSEVPIAKLRKAVKDGKLNLTKKELNGSGATLHVQPESYSKAQKAKKANKGVRLFITKHEIEHPIIEKSGSG |
| A0A2D4CCK7 | 2-89 | VYQKVSGLSISEAQARKAANGKPITLTKNQLSGGSVSLYLHPENARKIQAAKRAGRGTRIFIAPGEIEADLMEGGSFWSWLKGAAKSV |
| V9DTG1 | 1-92 | None |
| A0A329R779 | 1-63 | None |
| A0A2P4X2D2 | 1-94 | None |
| A0A0P1ACI7 | 1-97 | None |
| D0MVZ5 | 101-190 | None |
| W2PTH3 | 1-103 | None |
| A0A329SI25 | 1-97 | None |
| A0A5D6Y2V1 | 111-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.