DPCstruct | MC2181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9T2B9 | 208-297 | LLEQGDIKFAAIGLIAMYNGGGSILRIDMNGRSANVTAYGLGELACYASRAPTSVHVDGRAVSPDFDPRTGALSIDLGATEGTHELQ… |
| A0A5J5W2H1 | 9-97 | FAPIGLTKMFNSGGAIKGLKCETENPVATVIMKVRGCGPFGAYSSTKPQRITVDSEEVEFKYEGESGLVTFALKVPVEEQYLWNIVI… |
| A0A6A6MVM6 | 217-307 | None |
| A0A5B7A5Y3 | 344-438 | None |
| A0A679BA79 | 3-111 | None |
| A0A445AAQ5 | 675-767 | None |
| A0A426XR55 | 184-265 | None |
| A0A426Y444 | 181-245 | None |
| A0A392QX89 | 2-79 | None |
| A0A4S8IWW5 | 29-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.