DPCstruct | MC21808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 193 ± 23 aa |
| Standard deviation of domain lengths | 22.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813HKK3 | 29-228 | RTSDFALHFIAKVVKDSPCNFRDKLAALRFVAHQLVLVPEQLRALLLLFPRGPAAPSPRAEAFVLLYSRTLYHSEVISPQLLYDPLL… |
| A0A2D4C738 | 7-187 | VALKLVQIEAAVCDRWLSCSQAAEIIACMPNAYHARPETARLLFSRIIDIANFHRLFDAMTPDEQYVCAKSLGWLNIFNPMFPERAY… |
| A0A3F2RYK6 | 467-649 | None |
| A0A3R6W0F2 | 496-642 | None |
| D0NI40 | 1-165 | None |
| A0A7S3GA20 | 218-387 | None |
| A0A7S2MAM4 | 13-214 | None |
| A0A061QZ58 | 25-223 | None |
| A0A1Q9CBV9 | 776-952 | None |
| A0A7S1XZJ5 | 608-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.