DPCstruct | MC21806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 505 ± 70 aa |
| Standard deviation of domain lengths | 70.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4C2S0 | 2-496 | TDVPRSGIHNDLRQFKRVGQGEWMYFGPYAYVVSYFHTFEAADGSTGVIASTDIDGRNQAATARTWSYNLMYEDVRLPPTSTMRPRD… |
| A0A485LMV3 | 66-560 | EPNVYFSKGPLAYSVFQSSSSASMTSSVPVATYKTDASAVALRAVAFNQGVWPACLDYVTDCAENTLPFTQVFGMLDQIASFVASQP… |
| A0A1V9YIM1 | 2-330 | None |
| A0A2P4X6M8 | 1-596 | None |
| A0A662WSB2 | 63-638 | None |
| V9E2Z5 | 61-566 | None |
| A0A1V9YQ17 | 1-532 | None |
| K3WXX1 | 4-446 | None |
| K3WCD3 | 441-1069 | None |
| A0A1V9Y953 | 424-913 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.