DPCstruct | MC21801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 3.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2I833 | 872-933 | GDTLLGETSVKGTRENAFCSNHGICDFSTGICTCHANYGGSDGKGGPGTIANCGFHEVKYAT |
| A0A7S4DCI4 | 858-915 | GESTRGQTSVNGTTEYIECSGRGVCNYDSGLCECYTGYRSSNGNGKPGAKGECGYRIA |
| A0A5A8D4S9 | 115-179 | None |
| A0A1V9YUC9 | 914-976 | None |
| A0A6G0X4F1 | 455-511 | None |
| F0YG14 | 173-236 | None |
| A0A421F4J3 | 716-770 | None |
| D0RMF1 | 289-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.