DPCstruct | MC2180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 266 |
|---|---|
| Mean domain length (aa) | 404 ± 95 aa |
| Standard deviation of domain lengths | 94.73 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.57 |
| Pfam Score | 97.45 |
| Assigned Pfam label(s) | CL0059- PF11874- CL0182- CL0582- PF04290 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I3J6Z5 | 7-353 | ADAVAGAWTTTWPVLAFLLVITVVSDLCADVRLFEVAASAVARLARGRTPLLFAAHCLLATLTTVLLGIDTTAVMLTPVSLALATQV… |
| A0A3D4EGW7 | 29-416 | LVSVLQMDLPAMTLAINSNAALSKVVLEAIPFFILGGNIMEKSGISRKLIDFASAFVGHIKGGLIIVCVLCACFFAAISGSGPATVA… |
| A0A7R9A8T6 | 121-574 | None |
| A0A090MR67 | 2-248 | None |
| A0A0D8XV21 | 8-341 | None |
| A0A316RZ25 | 3-302 | None |
| A0A1Y2H6U6 | 8-467 | None |
| A0A1Q9C216 | 449-863 | None |
| A0A1V5ZQX9 | 3-390 | None |
| A0A7D7ZLM9 | 1-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.