DPCstruct | MC218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 50 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4KAP3 | 3-49 | FPDVDWSCDECFTYLNEQPGFTDENGSWTCTSCGHECAVTADNILSE |
| L1QJ81 | 2-53 | SNRFNDIDWYCDRCNAYLNQQLGFDDHRYIWKCTECGHKNSISESNIYESEE |
| A0A1G4QMK7 | 563-610 | None |
| A0A315XYE3 | 45-92 | None |
| A0A174AW12 | 14-71 | None |
| A0A174E6E0 | 3-45 | None |
| A0A285T623 | 90-139 | None |
| A0A1Y3WAH5 | 65-107 | None |
| A0A8A5CRG4 | 49-104 | None |
| A0A2N2N378 | 7-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.