DPCstruct | MC21799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 481 ± 89 aa |
| Standard deviation of domain lengths | 89.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.55 |
| Pfam Score | 80.02 |
| Assigned Pfam label(s) | CL0070- PF21078- CL0063- PF21079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1DPJ4 | 1-477 | MHFTVNEAGARAEVRWPGPPPLLAEVCAMFEHFGLRVASYQLTDTGHHYEFGTLPLPRPTLELIARAFEAATAGHWQTDRYAALIPS… |
| A0A858Q8P5 | 36-576 | SLPGAWVFPPEYRSRIPPAAALRDAIRLETVVRTGADTADLWRPSPCFGDPHHRLRIYSPVEQDLDRVMPFLQNLHLRIIDQIQFRL… |
| A0A1V9ZWE0 | 80-594 | None |
| A0A8A5WQT7 | 472-936 | None |
| A0A1G3R0N2 | 1-456 | None |
| A0A829Q4S5 | 17-531 | None |
| A0A812QVV0 | 2-531 | None |
| A0A2N1TGU3 | 190-905 | None |
| A0A401GRF2 | 8-414 | None |
| A0A7Y2YV14 | 140-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.