DPCstruct | MC21795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 140 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5Q854 | 62-189 | RRALTVEALFLLGLAFVGLPYLAAYLGQAAVAIYLLEFVNYLQHHGLRRGVDERANATHAWESRHRLSRWTLMELPLHPSHHLKAST… |
| A0A316FDW9 | 2-133 | SAVLWAAMIAWLGAGVLPYLIVQAVVGFSLLEIVNYMEHYGMLRQRVGAPGRRRYERVDPSHSWNSNNIATNVLLYHLQRHSDHHAN… |
| A0A7Y9YGZ1 | 239-396 | None |
| A0A449G633 | 234-366 | None |
| A0A7S4RM21 | 87-233 | None |
| A0A2W4WN51 | 7-146 | None |
| A0A077ZTT9 | 248-395 | None |
| A0A3C0IA67 | 206-361 | None |
| A0A5C6URG7 | 204-338 | None |
| A0A7Z9RYZ8 | 11-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.