DPCstruct | MC21794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 153 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6N3D5 | 106-237 | KPHRAPIAAALLSAWLGVFLPHAAVAYQKRLYATENICRMDSLLSGDECKYAFLNARAAVDEGAPRFSKREECEKYFHHCMIAGFHG… |
| A0A389M2W6 | 7-161 | LKLAILPAAILLLAACGETDIESSVYNNPQECSENMDAAICNEAFKEAQIANATEAPKYSTVKQCEIEHGVGKCEQNAQSGGSFFMP… |
| A0A376X6N9 | 4-140 | None |
| A0A485AGE4 | 1-158 | None |
| A0A5S4U7A3 | 20-192 | None |
| A0A1G8A0T6 | 1-148 | None |
| A0A2G4DI76 | 1-131 | None |
| A0A6I4TUC5 | 1-199 | None |
| V4NYT7 | 31-226 | None |
| V7ISB6 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.