DPCstruct | MC21793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1329 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 99.15 |
| Assigned Pfam label(s) | CL0023- PF14239- PF00926- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8P1J1 | 60-144 | LYSQRYNAKKKALPYDLSADELDDIYSQFNYSCALTGTSKNLHHEHFICIDTGHMGTTYGNIIPLDGSLNISKNNKNPFEWIKDF |
| A0A359BF23 | 18-82 | DAKRMWREEIKRRDGYRCVYCGSTDNLTIDHVVPQCKGGPTDAANCRTACLACNQAKGSLSLNDF |
| A0A6N0LVQ3 | 9-91 | None |
| A0A496SU11 | 184-256 | None |
| A0A843AW91 | 43-102 | None |
| A0A7C1Q0C4 | 122-197 | None |
| A0A6G2HIW3 | 3-78 | None |
| A0A7R8XLD4 | 5-80 | None |
| A0A1M7IWG6 | 91-180 | None |
| A0A350XTX7 | 226-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.