DPCstruct | MC21791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 144 ± 30 aa |
| Standard deviation of domain lengths | 30.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0ZJJ5 | 2-99 | YDTFRSSTTDVASITRNTGMKDSRVQRIKEHLFIKEHIKDHGVGRFDADYDIAQAWERLQKGTYNQSDIDLLNHELFESRFEGIFKT… |
| A0A7W7I3I4 | 73-229 | NTDAGVSVDRAAYGGHSRRPWNVADYERLHRWADDAYDHIRKYPDAEIIASRLSDVRRLDGSTGFAVDEIGRIRDHVFFEVHPLSDY… |
| A0A8B2X4X5 | 339-472 | None |
| A0A2S0UG23 | 38-170 | None |
| A0A518I2T3 | 467-622 | None |
| A0A0F7FCI3 | 635-792 | None |
| A0A841IN72 | 630-898 | None |
| A0A495L1C1 | 832-1040 | None |
| A0A2K8UDR3 | 10-137 | None |
| Q08WJ4 | 455-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.