DPCstruct | MC21790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534CEJ0 | 184-312 | VNLASIREAGPYALRGELKIEGRSQGYRATLCRCGASKNKPFCDGSHHDVGFSATGEPPSGKTDMLPVRDGVLAIEPQTNGPLAVRG… |
| A0A7W7I176 | 4-129 | PSIRITEDGPYRVEGEVSIRDTDGTELRTEGIWHLCRCGGSRNKPFCDSTHGLKGWTGPETADRGGDEPAEGPPSITPTVDGPYEVC… |
| A0A1Z8NSM8 | 2-133 | None |
| A0A399YX29 | 86-219 | None |
| A0A7X4DHJ9 | 9-141 | None |
| A0A6L7MD83 | 50-184 | None |
| A0A3M1ZV03 | 2-108 | None |
| A0A2T2TYG5 | 46-157 | None |
| A0A6L7R7H4 | 154-282 | None |
| A0A7Y4ZU70 | 527-655 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.