DPCstruct | MC2179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 149 ± 19 aa |
| Standard deviation of domain lengths | 19.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8N8P0 | 17-171 | PGLRVVYYCYGSAHSSIVCAAIHLGRLTGNRVRGRDIVQLADYDATEPWSIGTVYFKGVDDLGHPVYTLGLGPRRKAALEAVIALLA… |
| A0A3D2KP39 | 17-175 | TRRGDLLVIYHCHGGAHASVVCAAVHLGLLPADRVPTADELWAVRWFGREEPADHGRIRCMGVDSRGTKVCVLGRRNVFRVLRRAVE… |
| A0A7C6JRT7 | 1-183 | None |
| A0A7C7DDZ7 | 30-188 | None |
| A0A3B9SR15 | 49-194 | None |
| A0A2R4MZX9 | 2-156 | None |
| A0A7C6X432 | 59-216 | None |
| A0A7X8U228 | 1-148 | None |
| A0A7C6LJL4 | 2-158 | None |
| A0A3G1KNR9 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.